(data stored in ACNUC29543 zone)

EMBL: CT978603.PE295

CT978603.PE295       Location/Qualifiers
FT   CDS_pept        291030..292322
FT                   /transl_table=11
FT                   /gene="SynRCC307_0295"
FT                   /locus_tag="SynRCC307_0295"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27198"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN9"
FT                   /protein_id="CAK27198.1"
FT                   /translation="MTSACSTPQPCDGLIRFCSNSSPTVSESDHSAEALEARWHQQLAE
FT                   IPEQAWDALVASAGLPFYRWAWLEALERSGSIVPSQGWQACHLSLWREQQLIAVAPLYV
FT                   KGHSYGEFVFDQSFAQLAGQLGLRYYPKLLGMSPLSPILGYRFFIASNEEEGACTALML
FT                   RLIDRFCERNQLLSCNFLYVDPAWRPHAEAAGCSAWLNQQSLWSNPGYGSFEDYLASFN
FT                   ANQRRNIRRERKAVQQAGLQVSAIAAEAITPELLERMHGFYEDHCRRWGMWGSKYLTEE
FT                   FFSLAQQLRQHLVLFSAHRHGEDPHQPIAMSLCVREGDHLWGRYWGSTVEIDNLHFEVC
FT                   YYAPIEWAIAQGIRHYDPGAGGSHKRRRGFVARPHASLHRWYEPQFAGLIKRWLPLANA
FT                   QQLEEVEAINAELPFSGRQIPLAPEQGKIEG"
     gtgacctcag cctgcagcac tccccagccg tgcgatggcc tgattaggtt ttgcagcaac        60
     tccagcccca ctgtgagcga gtccgatcac tccgctgagg ccttggaggc gcgctggcat       120
     cagcagctcg ccgagattcc tgagcaggct tgggatgctc tggtggcctc cgctggactg       180
     ccgttctacc gctgggcttg gctggaagcc ttggagcgct ccggaagcat tgttccctcc       240
     cagggctggc aggcttgcca cctcagcctg tggcgcgagc aacagctgat cgccgtggcg       300
     ccgctctacg tcaaaggcca tagctacggc gagttcgtct ttgatcaatc cttcgctcaa       360
     ctcgctggac agttgggcct gcgctactac cccaagctgc tgggcatgag cccattgagc       420
     ccaatcttgg gctatcgctt cttcattgcc agcaacgaag aggagggcgc ttgcaccgcg       480
     ttgatgctgc gcttgatcga tcgcttttgc gagcgcaacc aactgctgag ttgcaacttc       540
     ctctatgtcg atccggcttg gcggccccac gccgaagccg ctggctgctc cgcctggctc       600
     aatcagcaga gcctgtggag caatcccggt tacggcagct ttgaggacta cctcgccagc       660
     tttaacgcca accaacgccg caatatccgc cgcgaacgca aggccgtgca gcaagcgggc       720
     ctgcaggtga gcgccattgc cgcggaagcg atcacgccgg agctgctgga gcgcatgcat       780
     ggcttttatg aagaccattg ccgccgctgg ggcatgtggg gcagtaagta cctcaccgaa       840
     gagttcttct cactggcgca gcagttgcgt cagcacctgg tgctgttcag tgcccatcgc       900
     cacggggagg atccccatca gcccatcgcc atgagcctct gcgtgcggga gggcgatcac       960
     ctctggggcc ggtattgggg ttcaacggtg gagatcgaca atctccactt tgaggtctgc      1020
     tattacgcgc cgattgaatg ggccatcgct cagggcattc gccattacga cccaggtgcc      1080
     ggcggtagcc acaagcgccg ccgcggtttt gtggcccgac cgcatgccag cttgcaccgc      1140
     tggtatgagc cccagttcgc cggcttgatc aagcgttggt tgccattggc caatgcccag      1200
     cagctggagg aggtggaggc gattaacgca gagttgccgt ttagcggccg ccagatcccg      1260
     ctggccccag agcagggcaa aatcgaaggc tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page