(data stored in ACNUC29543 zone)

EMBL: CT978603.PE296

CT978603.PE296       Location/Qualifiers
FT   CDS_pept        292336..292722
FT                   /transl_table=11
FT                   /gene="SynRCC307_0296"
FT                   /locus_tag="SynRCC307_0296"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27199"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP0"
FT                   /protein_id="CAK27199.1"
FT                   /translation="MAPLSPQQRRELDDAHSNRTIELDPSGYFLIRVDAAAGELVVQHF
FT                   GNAINDQGLATDPDTGEVLSCRGGGPRAASAEYRGRSAKELGMALTESAEPLPLSRLDH
FT                   ALYLGRELQKAELCLEQGLDYVQD"
     atggcaccgc tctcgcccca gcagcgccgc gagctggatg atgcccactc caaccgcacg        60
     atcgagctcg atcccagtgg ctattttctg atccgcgtgg atgctgctgc tggcgagctg       120
     gtggtccagc acttcggcaa tgccatcaat gaccaggggc ttgccaccga tccagacact       180
     ggtgaggtgc tcagttgccg cggtggcggc ccacgtgcag cgtcagcgga ataccgcggc       240
     cgcagcgcca aagagctggg catggcgctg accgaaagcg ccgagccttt gccgctcagt       300
     cgattggatc acgccttgta cctgggccgt gagctgcaaa aagcggagct ctgcctcgag       360
     cagggcctcg actacgtgca ggactga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page