(data stored in ACNUC29543 zone)

EMBL: CT978603.PE305

CT978603.PE305       Location/Qualifiers
FT   CDS_pept        complement(301022..301726)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0305"
FT                   /locus_tag="SynRCC307_0305"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27208"
FT                   /db_xref="GOA:A5GQP9"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQP9"
FT                   /protein_id="CAK27208.1"
FT                   /translation="MFTQLLFGAAPVLNPAPQLNAAGVSWKTSAPAMAAALVMLPVFAQ
FT                   APWVRSSPVACALFTAVLVALGLRLRGDLGALLIGFSGSWLAGAVFWGWMRMHPLWHLP
FT                   VEAFALPLAIAGLQGPWRRAGQFYLGALIGTACTDAATALCGLMPLWPQVLQASPSEAP
FT                   LLLSAAAEQVLQPLPLAVVSGFAAAMLAAGRWLWRQGEGGQVVAASLLSTLAVDALFLA
FT                   LALLSPQLSGLV"
     ttgttcacac agctgttgtt cggagctgcc cccgtcctca atccggcgcc gcagctcaac        60
     gcagctggtg tgagctggaa aacatcagcg ccggccatgg cagccgcgct ggtgatgctg       120
     ccggtgtttg cgcaggctcc ctgggtgcgc agttccccag tggcctgtgc gctgttcaca       180
     gctgttttgg tggcgttggg gctgcggttg cggggcgacc tcggcgccct gctgattggc       240
     ttttccggca gctggctggc cggagccgtg ttttggggtt ggatgcggat gcatcccctc       300
     tggcatttgc cggttgaagc ctttgcgctg cccctggcaa tcgccggatt gcaggggcct       360
     tggcgcaggg ccgggcagtt ctatctgggc gccttaatcg gcaccgcctg caccgatgcc       420
     gccacggctc tttgcggctt gatgccgctg tggcctcaag tgctgcaagc cagccccagt       480
     gaggcacctc tgttgctttc cgcagctgca gagcaagtgc tgcagccgct gcccttggct       540
     gtggtcagtg gatttgccgc ggccatgctg gctgcggggc gctggctgtg gcgtcaaggc       600
     gaaggcggac aagtggtggc agcaagcctg ctcagcacct tggcggtgga tgccctgttc       660
     ctggcgttgg ccctgttgag cccgcaactc agcggcttgg tttaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page