(data stored in ACNUC29543 zone)

EMBL: CT978603.PE310

CT978603.PE310       Location/Qualifiers
FT   CDS_pept        307325..308119
FT                   /transl_table=11
FT                   /gene="SynRCC307_0310"
FT                   /locus_tag="SynRCC307_0310"
FT                   /product="Inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27213"
FT                   /db_xref="GOA:A5GQQ4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQQ4"
FT                   /protein_id="CAK27213.1"
FT                   /translation="MATYPHGAHWPALHELVDRVAERQRADFGQIASTVKPDGSLVTDC
FT                   DRWSDATIAAGLAAILPGDGLLSEEGCTDSPTQRHGWIVDPLDGTTNFSVGLPIWAISM
FT                   ARLQDGQPLEAIIDVPPLRERYVAVRGQGVWRNGEPLQPPGGPRHRCNCASLCTRSLPV
FT                   LQKVPGRFPAKTRMLGVASLNLLGVGLGTMLAALEATPKIWDLAAVWLILEELGCVIRP
FT                   LADHPFPMTPGAPLGEASYPLMAACDEEHYQRFLPWGQALVS"
     atggcgacct atccccatgg ggcccactgg ccggccttgc atgagcttgt cgatcgggtc        60
     gcagagcgtc agcgcgctga cttcggccag atcgccagca cggtgaagcc cgatggcagc       120
     ttggtcaccg actgtgatcg ctggagtgac gccaccatcg ctgcaggctt ggcggcgatc       180
     cttcccggcg acggcctgct cagcgaagaa ggctgcaccg attccccaac ccagcgccac       240
     ggctggattg ttgaccccct tgatggcacc accaatttct cggtgggcct gccgatttgg       300
     gcgatttcga tggcgcgtct gcaggatggc cagcccctcg aggccatcat cgatgtgccc       360
     ccgctccggg agcgttatgt ggcggtgcgc ggccagggcg tttggcgcaa tggtgagcca       420
     ttgcagcccc ctggcggtcc tcgccatcgc tgcaattgcg ccagcctctg cacccgctcg       480
     ctgcctgtgc tgcagaaggt ccctgggcgc ttccccgcca aaacgcgaat gctgggggtg       540
     gccagcctca acctgctggg tgtggggcta ggcacgatgc tggccgccct cgaggccact       600
     cccaagatct gggatctcgc agcggtgtgg ctgatcctcg aggagcttgg ttgcgtgatt       660
     cgtccgctgg cggatcaccc cttcccgatg acgccaggag ctcccttggg tgaggcgagc       720
     tatcccttga tggccgcgtg cgacgaagag cactaccagc ggtttttgcc ctggggtcaa       780
     gcgctggtta gctag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page