(data stored in ACNUC29543 zone)

EMBL: CT978603.PE317

CT978603.PE317       Location/Qualifiers
FT   CDS_pept        315275..315655
FT                   /transl_table=11
FT                   /gene="SynRCC307_0317"
FT                   /locus_tag="SynRCC307_0317"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27220"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR1"
FT                   /protein_id="CAK27220.1"
FT                   /translation="MRRSLWLLPLAAGLVFGSAELPKAQAGNLGDAVEPSNAEQLSLAR
FT                   ELKQAGVIFYGAWWCGACFHQKNLFGTEAGRELPYVECDKDDAGREQCRKAQIKAFPTW
FT                   VLGDQRAEGVMTLPQLRSWAGL"
     atgcgtcgct ctctttggtt gctgcccttg gcggcagggt tggtgttcgg ttctgcggaa        60
     ctgcccaagg cgcaggccgg caacctgggt gatgccgttg agccctccaa tgctgagcaa       120
     ttgagcttgg cccgtgagct caagcaagcc ggcgtcattt tttatggcgc ctggtggtgc       180
     ggcgcctgtt tccaccaaaa gaatctgttt ggcaccgagg cggggcgtga actgccctat       240
     gtggagtgcg acaaagatga cgccgggcgt gagcaatgcc gcaaagctca gatcaaggcc       300
     ttccccacct gggtcttggg ggatcaacgc gctgagggcg tgatgacctt gccgcaactg       360
     cgcagctggg ctgggctcta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page