(data stored in ACNUC29543 zone)

EMBL: CT978603.PE322

CT978603.PE322       Location/Qualifiers
FT   CDS_pept        complement(317519..317938)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0322"
FT                   /locus_tag="SynRCC307_0322"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27225"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQR6"
FT                   /protein_id="CAK27225.1"
FT                   /translation="MNVFLLLATLVALTPVRANPLVAPPPEASGPRELPAMPKTTAASA
FT                   SQLDPSWEWFKDQTGMYGIKWDGWKDGRYGNRYAAVNDLSPGIGGKLLAVGVNCQAFKI
FT                   AWNQDNGQSKAWTAWEYPISRSVSEQIMLKLCEGN"
     atgaacgtat ttctgctgtt ggcaacgctg gttgccttaa cgcccgtacg cgccaatccc        60
     ctcgtggcgc cgccaccaga ggcaagtggg cctcgcgagc tgccagctat gccgaaaaca       120
     acagcagctt cggcctccca actcgacccg agctgggaat ggttcaaaga tcaaaccggg       180
     atgtatggaa tcaaatggga tggctggaaa gatggccgct atggcaaccg ctacgccgct       240
     gtgaatgacc tctcgcctgg cattggcggc aaattgttag ccgttggcgt gaattgccaa       300
     gccttcaaga ttgcttggaa tcaagacaac ggtcagagca aagcctggac ggcctgggaa       360
     taccccattt cacgctcggt gagcgagcaa atcatgctga agctctgcga agggaattaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page