(data stored in ACNUC29543 zone)

EMBL: CT978603.PE327

CT978603.PE327       Location/Qualifiers
FT   CDS_pept        320090..320269
FT                   /transl_table=11
FT                   /gene="SynRCC307_0327"
FT                   /locus_tag="SynRCC307_0327"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27230"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS1"
FT                   /protein_id="CAK27230.1"
FT                   /translation="MGDERWVVVNACDVFNNYREVACFYSSDDAFDYIDQHCDEDSHVE
FT                   ERFLPLRRVVMVEP"
     atgggtgatg agcgttgggt ggttgtgaat gcgtgcgatg tgttcaacaa ctaccgcgaa        60
     gtggcttgct tctacagctc tgatgatgcg ttcgactaca tcgatcagca ttgcgatgaa       120
     gacagccatg ttgaagaacg tttcctccca ctccgccggg tggtgatggt ggagccgtga       180
//

If you have problems or comments...

PBIL Back to PBIL home page