(data stored in ACNUC29543 zone)

EMBL: CT978603.PE333

CT978603.PE333       Location/Qualifiers
FT   CDS_pept        complement(321744..322085)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0333"
FT                   /locus_tag="SynRCC307_0333"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27236"
FT                   /db_xref="GOA:A5GQS7"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQS7"
FT                   /protein_id="CAK27236.1"
FT                   /translation="MNGRHGSGGASSMGRLWEAVLFIACLVIRLYYSLAMKEAWLKQPN
FT                   GPWVERFWPNPELERDGGARPMAVDLGRHLLLHEPPLLKSRRQLTLSQARELWRNRVKA
FT                   GWKRVEPQW"
     ttgaatggcc gccatgggag tggtggcgct tcgagcatgg gacggctgtg ggaggccgtc        60
     ctttttattg cttgcctagt aatacgcttg tactactctt tggccatgaa agaagcctgg       120
     ctgaagcaac ccaacggtcc atgggtcgag cggttctggc ccaatccaga gcttgagcgc       180
     gacggtggcg ccaggcccat ggcggtggac ctaggcagac accttctgct ccatgaacca       240
     cccctgctga agtcacggcg ccaactcacg ctcagccaag cccgcgagct gtggcgcaat       300
     cgggtgaaag cgggctggaa acgtgttgaa ccgcagtggt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page