(data stored in ACNUC29543 zone)

EMBL: CT978603.PE338

CT978603.PE338       Location/Qualifiers
FT   CDS_pept        328271..329215
FT                   /transl_table=11
FT                   /gene="SynRCC307_0338"
FT                   /locus_tag="SynRCC307_0338"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27241"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT2"
FT                   /protein_id="CAK27241.1"
FT                   /translation="MQAPPPSDSTPAPSDRLWLRSELMGTQVITTDTGRRLGVVGEVLV
FT                   DIDRREVVALGLRDNPLTRFLPGLPRWMPLEQIRQVGDVILVDSLDSLAEGFNPDRYDR
FT                   VINCQVVSEAGEQLGRVLGFSFDIETGELTTLVVGAVGVPLLGEGILSTWELPVDEIVS
FT                   SGPDRIIVYEGAEEKLKQLNTGLLEKLGIGGGSLEREERERYRLNMVPVENQLPAGVPT
FT                   EQEQRRLEASRQERFEPQRQEDDYEYVELEQRQRREPQRLYMDEERDPYGERDRYAERD
FT                   RYRDRYDAPLDVEPEPLPEPRRGPQPAEEDPWA"
     ttgcaggcgc cccccccttc cgattccacc ccagcaccct ccgatcggct ttggctgcgt        60
     tcggaattga tgggaaccca ggtcattacc actgacaccg gccgccgtct tggcgtggtg       120
     ggcgaagtct tggtggacat cgaccgccgc gaggtggtgg cccttggcct gcgcgacaac       180
     ccgttgaccc gttttctgcc tggtctgccg cgttggatgc cgctggagca gatccgtcag       240
     gtgggtgatg tgatcttggt tgattccctc gactccctgg ctgagggctt caaccccgat       300
     cgctacgacc gggtgatcaa ttgtcaggtg gtctcggaag ccggtgagca gcttggccgg       360
     gttctgggtt tcagttttga catcgaaacc ggtgagctca ccaccttggt ggtgggcgct       420
     gtgggcgtgc cccttctggg tgaaggcatc ctcagtacct gggagctgcc cgttgatgaa       480
     atcgtcagct cgggcccgga tcgaatcatt gtttatgagg gcgcggaaga gaagctcaag       540
     cagctcaaca ccggtttgct cgaaaagctg ggtataggag gcggcagcct cgagcgcgaa       600
     gagcgtgagc gctaccggct caacatggtg ccagttgaaa atcagttgcc ggccggcgtt       660
     cccactgaac aggagcagcg gcgccttgag gcctctaggc aagagcgttt tgagccccag       720
     cgccaggaag acgactacga atacgtggaa cttgaacagc gccaacgccg cgagccccag       780
     cgcctctata tggatgagga gcgcgatccc tatggcgagc gggatcgcta cgccgagcgt       840
     gatcgctacc gcgaccgcta cgacgcgcca ttggatgtcg agcccgagcc gctgccagaa       900
     ccccgcaggg ggcctcagcc cgctgaagaa gacccctggg cgtaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page