(data stored in ACNUC29543 zone)

EMBL: CT978603.PE344

CT978603.PE344       Location/Qualifiers
FT   CDS_pept        332974..333828
FT                   /transl_table=11
FT                   /gene="SynRCC307_0344"
FT                   /locus_tag="SynRCC307_0344"
FT                   /product="Conserved hypothetical protein with a ycf66
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27247"
FT                   /db_xref="GOA:A5GQT8"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT8"
FT                   /protein_id="CAK27247.1"
FT                   /translation="MVNASLNWASIVGIVLAVGGCVLYFLRSFKPGLARDYDVFFAAVG
FT                   LLCGGILFFQGWRLDPILQFGQFLLASTTVFFAYESVRLRSVTTEQARRSAYFDDDEPV
FT                   PSRPRMGRGEWGGDERFDDPQPLRRRIRSRADGSDDGDERGDQEDFYRPRRPERRAIPE
FT                   RAESRFDEADAEDRGGRGSRERSRYGASTREPRPEFGARRRERDASSTRRSGSRPGGAT
FT                   DDMPRSSRRPSSRPVAAARPDRPSSTSMPEGAPISDADFSPISSRPAPSQPANRDNSSR
FT                   FDD"
     atggttaatg ccagcctgaa ttgggccagc atcgttggca tcgtccttgc tgtgggcggc        60
     tgcgtgctgt acttcctgcg cagcttcaag ccagggctgg cccgtgatta cgacgttttc       120
     tttgctgccg ttggtttgct gtgcggcggc atcctctttt ttcagggatg gcgtttagat       180
     cccatccttc aattcggtca gtttctttta gcctccacca ccgttttctt tgcctacgag       240
     tcggtgcgcc tgcgcagcgt caccaccgaa caggctcgtc gttcggccta cttcgacgac       300
     gacgaaccgg tgccctctcg cccacgcatg ggtcgcggtg agtggggtgg cgatgagcgc       360
     ttcgatgatc cccagccctt gcgccgcagg attcgctccc gcgccgatgg ctctgacgac       420
     ggcgatgagc gcggtgatca ggaggatttc taccgcccgc ggcgtcctga gcgccgtgcg       480
     atccctgagc gcgccgagag ccgtttcgat gaggccgacg ctgaggatcg cggtggccgc       540
     ggcagccgtg agcgcagccg ttatggcgcc agcacccgag agccgcgccc tgagtttggc       600
     gcccgccgtc gtgagcgcga tgccagcagc acccgtcgca gtggctctcg ccccggtggt       660
     gccacagacg acatgccccg ctccagtcgc cggccctcga gccgtcctgt ggcggctgcc       720
     cgtccggatc gccccagcag cacatcaatg cccgaaggcg ctcccatcag cgacgctgac       780
     ttctcaccga tcagtagccg tcctgcccca tcgcagccgg ccaaccgcga taacagctcc       840
     cgtttcgacg actga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page