(data stored in ACNUC29543 zone)

EMBL: CT978603.PE345

CT978603.PE345       Location/Qualifiers
FT   CDS_pept        333837..334325
FT                   /transl_table=11
FT                   /gene="SynRCC307_0345"
FT                   /locus_tag="SynRCC307_0345"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27248"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQT9"
FT                   /protein_id="CAK27248.1"
FT                   /translation="MRRALLLLVLVLLAGCSQRYSAPGLGDQEDPALSGNGRLLVSVVD
FT                   RGGRRSLRLVERSTGRELPLPGLRQGQPHRSPSLSWTGRYLAFIRQRGTRPEAVLLDRL
FT                   SGRLQPLALPNDRLPERLSLAPDGQQLAVQVLRRGQLDLELFRLPGLEPDLPAGAPLP"
     gtgcggcgcg cgctgctgct gcttgtgctg gtgctgctgg ctggatgtag ccagcggtat        60
     tcagctccag gtcttggcga tcaagaagat cctgccctca gcggtaatgg acgcttgctg       120
     gtgagcgttg tcgatcgtgg tggccgccgt tccttgcggc tcgtggaacg ctccaccggc       180
     cgggaattgc cattgccagg cctgcgccaa ggccagccgc accgctcgcc atcgttgagt       240
     tggaccggcc gttatctcgc cttcatccgc caacgcggca cacgcccaga ggctgtgctg       300
     ctcgatcgtc tcagcggccg tttgcagccc ttggccctgc ccaatgaccg gctgcctgag       360
     cgactcagcc tggcccccga tggtcagcag ctggcggttc aagtgctgcg tcgcggtcag       420
     ctggatttgg agctgttccg cttgcccggg cttgagcctg atctgccggc aggagcgccg       480
     ctgccatga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page