(data stored in ACNUC29543 zone)

EMBL: CT978603.PE346

CT978603.PE346       Location/Qualifiers
FT   CDS_pept        334322..334801
FT                   /transl_table=11
FT                   /gene="SynRCC307_0346"
FT                   /locus_tag="SynRCC307_0346"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27249"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU0"
FT                   /protein_id="CAK27249.1"
FT                   /translation="MRLLASTLLGLVLLSGCQGLRLQPLMGVNTRLSTPGDDRSPSMAR
FT                   QGVVWIAPGPAGQHQVRWFDLASGMGGPLPGLNRPDAQPISVSVDAKGSRIALVRSLDG
FT                   RTELLLYNRNLASVRPLMLVPAGVPARVALSADGQQLAVQVSRGGRWEVEVMRVP"
     atgaggttgc tggcttcgac tctgcttggg ctcgtgctgt tgagcggttg ccagggcctg        60
     cggctgcagc cgctgatggg cgtcaacacc cgcctctcca caccaggcga tgaccgctcc       120
     ccctcgatgg cccgtcaggg ggtggtgtgg attgccccgg gtcccgccgg ccagcatcag       180
     gtgcgctggt ttgatctggc cagcggaatg ggcggcccgt tgccaggtct caaccggccc       240
     gatgcccagc ccatcagcgt cagtgttgat gccaagggat cccgcatcgc cttggtgcgc       300
     agcctcgatg gccgcaccga gttgttgctc tacaaccgca acctggccag cgtgcggccg       360
     ttgatgctgg tgcctgccgg ggttccggcc cgtgtggcgc tcagcgctga tgggcagcag       420
     ctggccgtgc aggtcagccg cggcgggcgt tgggaggtgg aggtgatgcg tgtgccttag       480
//

If you have problems or comments...

PBIL Back to PBIL home page