(data stored in ACNUC29543 zone)

EMBL: CT978603.PE353

CT978603.PE353       Location/Qualifiers
FT   CDS_pept        complement(340022..340585)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0353"
FT                   /locus_tag="SynRCC307_0353"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27256"
FT                   /db_xref="InterPro:IPR022222"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQU7"
FT                   /protein_id="CAK27256.1"
FT                   /translation="MLSAFRRLAPALVGLASATTALLSQPAQAGLFDAKEVETTQFVLV
FT                   AAPIPSGGAQLNIYEQKKDTRPCFSREGNAPTTVKPLLATFDFTGICGRYMDSNGYSVR
FT                   IGEIDYGSAMRLRVEILEEDIVLMSTGPNGGEVVMARAGGIDDGYVELKLEPGWSLKRR
FT                   HYGERALGHLYVHNESLPIRRDQE"
     gtgttgtctg cctttcgccg cctcgcccct gccctcgtgg gactggccag cgctacgact        60
     gccctgctca gccagccagc tcaagcagga ctgtttgatg ccaaagaggt ggagaccacc       120
     cagttcgtcc tggtggccgc cccgattcct agtggcggcg cccagctcaa tatctacgag       180
     caaaagaaag acacccgtcc ctgctttagc cgggagggca atgcccccac cacggtgaag       240
     ccgctgctgg ccacctttga tttcacaggg atctgtggcc gctacatgga cagcaatggc       300
     tattccgtgc gcattggcga gattgattac ggctcagcga tgcgcctgcg cgtggagatc       360
     ctggaagagg acatcgtgct gatgagcacc ggtcccaacg gcggtgaagt ggtgatggcc       420
     agagccggcg gcattgatga cggctatgtg gagctgaaac tcgagccagg ctggagcttg       480
     aagcgccgcc actacggcga gcgggccctg ggccacctct atgtgcacaa cgaaagcctg       540
     ccgattcgcc gcgatcagga atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page