(data stored in ACNUC29543 zone)

EMBL: CT978603.PE366

CT978603.PE366       Location/Qualifiers
FT   CDS_pept        complement(355603..355953)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0366"
FT                   /locus_tag="SynRCC307_0366"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27269"
FT                   /db_xref="GOA:A5GQW0"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW0"
FT                   /protein_id="CAK27269.1"
FT                   /translation="MNSSQGRQLIYLLLTISGTVLTQRANWQFIQENGGFALGEFIAQA
FT                   GATAAGQSLSWDLVIGATAGVMAMIVEGRRLQMRHLQWPVLASMLIAFAAGAPLFLLMR
FT                   ERHLQQLEDANG"
     atgaacagca gccaaggcag acaactgatc tatctgctgc tgaccatcag cggcacggtg        60
     ttgacgcaac gggccaattg gcaattcatc caagagaacg gcggctttgc cttaggcgaa       120
     ttcattgccc aagccggagc caccgcggcc gggcaatccc tgagctggga tttggtgatt       180
     ggggccaccg ccggtgtgat ggcgatgatt gtggaggggc gcaggctgca gatgcgccat       240
     ctgcaatggc cggtgctggc ctccatgctg attgcctttg ccgccggtgc tccgctgttt       300
     ttgctgatgc gggagcgcca cctgcagcaa cttgaagacg ccaatggcta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page