(data stored in ACNUC29543 zone)

EMBL: CT978603.PE373

CT978603.PE373       Location/Qualifiers
FT   CDS_pept        complement(359174..359578)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0373"
FT                   /locus_tag="SynRCC307_0373"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27276"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW7"
FT                   /protein_id="CAK27276.1"
FT                   /translation="MQAGARQADPRTRVVLAVLKAVKLPPRFRLKLVKDDPVRLELTLT
FT                   PAYGKDPILVGIVESQDLVARRDREGRIPRDLQGTWDWTVRHGKVSTGGWNPYLKEALQ
FT                   TMFETGLPAIVYEETTGEAYHPVDGTRHVR"
     atgcaggcag gagctcgcca agccgatcca cgcacccgag tggtgctcgc tgttcttaag        60
     gccgtcaagc tgcctcctcg ctttcgcctg aagctggtca aagatgaccc cgtgcgcctg       120
     gagctcacac tgacgccggc ctacggcaaa gaccccatcc tggtgggcat cgtggaatcc       180
     caggatctgg tggcccgccg cgaccgcgaa gggcgcatcc cccgtgatct acaaggaacc       240
     tgggattgga cggtgcgcca cggcaaggtg tccaccggag gctggaaccc ctacctcaaa       300
     gaagctctgc aaaccatgtt tgaaacaggg ctcccggcga ttgtttacga agaaaccacc       360
     ggcgaggcgt atcacccggt ggatggcacg cgccacgtgc gctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page