(data stored in ACNUC29543 zone)

EMBL: CT978603.PE374

CT978603.PE374       Location/Qualifiers
FT   CDS_pept        complement(359602..359847)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0374"
FT                   /locus_tag="SynRCC307_0374"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27277"
FT                   /db_xref="GOA:A5GQW8"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW8"
FT                   /protein_id="CAK27277.1"
FT                   /translation="MADGLLTQLFPLLYLTCLGLLLWQAFRVMGRGFSAAQKSVQPPAN
FT                   VHPELLDANGQITEEELLTVRFEAEPSADGSDDHAS"
     atggctgacg gccttttgac tcaactgttc ccactgctct acctcacctg tctggggctg        60
     ctgctctggc aggcttttcg ggtgatgggg cgcggcttca gtgcggcgca gaaatcagtg       120
     cagccgccgg ccaacgtgca ccccgagctc ttggatgcca acggccaaat caccgaagag       180
     gaactcctaa cggtgcgctt tgaggctgag cccagtgccg acgggtccga tgatcacgca       240
     agctag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page