(data stored in ACNUC29543 zone)

EMBL: CT978603.PE377

CT978603.PE377       Location/Qualifiers
FT   CDS_pept        complement(361489..361674)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0377"
FT                   /locus_tag="SynRCC307_0377"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27280"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX1"
FT                   /protein_id="CAK27280.1"
FT                   /translation="MDSAAALSLGQRFELERMNRAIDAEMDPTAVRGIAKQLLQAWQSQ
FT                   RAASRWLLSQQSDQQS"
     atggattccg ccgccgccct cagtcttggc caacgctttg agctggaacg gatgaatcgc        60
     gctatcgacg ccgaaatgga tcccaccgcc gtgcgcggca ttgccaagca gctgctgcag       120
     gcctggcaaa gccaacgggc cgcatcccgc tggctgctca gccagcagag tgatcagcag       180
     agttga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page