(data stored in ACNUC29543 zone)

EMBL: CT978603.PE383

CT978603.PE383       Location/Qualifiers
FT   CDS_pept        complement(364835..365095)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0383"
FT                   /locus_tag="SynRCC307_0383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27286"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX7"
FT                   /protein_id="CAK27286.1"
FT                   /translation="MRMLMEPAIPAMAASADKSDVLVSAVMSTYLLTHLHHVLQRAEFS
FT                   ATREGRPAMARNYAKLRKVLCLDARTMRDASAMETSEDWAA"
     atgcgtatgc tgatggaacc ggcaatcccc gccatggccg cctccgctga caagagcgat        60
     gtgctcgtct ccgctgtgat gagtacctat ctgctgaccc atctccacca cgtgttgcag       120
     cgggcggaat tcagcgccac gcgcgagggc aggccagcga tggcaaggaa ttacgccaag       180
     ctgcgcaagg tgctttgcct cgatgcacgc accatgcggg acgcctccgc catggagacc       240
     tccgaagact gggcggcctg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page