(data stored in ACNUC29543 zone)

EMBL: CT978603.PE393

CT978603.PE393       Location/Qualifiers
FT   CDS_pept        372013..372672
FT                   /transl_table=11
FT                   /gene="SynRCC307_0393"
FT                   /locus_tag="SynRCC307_0393"
FT                   /product="4'-phosphopantetheinyl transferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27296"
FT                   /db_xref="GOA:A5GQY7"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY7"
FT                   /protein_id="CAK27296.1"
FT                   /translation="MAAMQSGSEPKQPQLWCGLLPGCSDDRLASLLSAQELAWGEALPQ
FT                   RRRLIFWQTRAVVRQQLAAWLGCTPEAVPLLAPPAHYPQLAAGWGYVSWSHSGEQLLLG
FT                   WSPQPVGVDLEPADRPIRADSLWRRLCPGEPPPAALADAVLQRWVALEALTKRRCSSIA
FT                   VELGRWSWQLEQGRAVHRGDQHNVDVVAQRHHLQQRSWWLGWSGGAMPAVALEEGG"
     atggctgcaa tgcaatcggg gagcgagcct aagcagccgc agctctggtg cggtctcctg        60
     ccgggctgct ctgacgatcg gttggcatcg ctactcagcg cccaagagct ggcctggggg       120
     gaagcgttac cgcagcgccg gcgcctgatc ttttggcaaa cccgcgctgt ggtgcgccag       180
     cagcttgctg cttggctggg ctgcactcca gaggctgtgc cgttgctggc accaccggcc       240
     cactatcccc agctcgccgc tggctggggg tatgtgagtt ggagccacag cggcgagcag       300
     ctgctcttgg gttggtcgcc tcagcctgtg ggggtggatc ttgaacctgc agatcgcccg       360
     attcgagcgg actctttgtg gcggcgtctt tgccctgggg agcctccgcc tgctgccttg       420
     gctgatgcgg tgttgcagcg ctgggtggcg ctggaggcat tgaccaaacg ccgctgcagc       480
     agcatcgccg tggaactggg gcgctggtca tggcaattgg agcaaggtcg agctgtgcat       540
     cgcggtgatc agcacaacgt cgatgttgtg gcccagcgcc atcacctgca gcagcgcagc       600
     tggtggctgg gctggagtgg tggtgcgatg cccgctgtag cgcttgagga aggcggctaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page