(data stored in ACNUC29543 zone)

EMBL: CT978603.PE394

CT978603.PE394       Location/Qualifiers
FT   CDS_pept        372682..373203
FT                   /transl_table=11
FT                   /gene="SynRCC307_0394"
FT                   /locus_tag="SynRCC307_0394"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27297"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY8"
FT                   /protein_id="CAK27297.1"
FT                   /translation="MVQPLRLSMIVLLTLLGVCGLVRLPLMPPLLARSGSDTQLSDLEA
FT                   QEALLEARQEAASQMTRFVGGQITRHYWGGFTPYLDVLGVEIPETMESTLTVGDDRARL
FT                   VLDPKRVNERYVAEVVRAGTRARGVVCRGQGEPGAFVLRGRRLDCPEGWLVINDPLLTS
FT                   SGEQQPEPIN"
     atggttcaac ccctacggct cagcatgatc gtgctgctca ccctgcttgg ggtgtgtggc        60
     ttggtgcgtt tgccgttgat gccaccgttg ttggcccgtt cgggttccga tacgcagctc       120
     tccgatctcg aagcccagga agcgttgttg gaagctcggc aagaggcggc ctcacaaatg       180
     acgcgatttg tgggcgggca gatcacgcgc cactactggg gcggtttcac cccttatctg       240
     gatgtcttgg gggtggagat ccccgagacg atggaatcaa ccctcacggt gggtgatgac       300
     cgggcgcgct tggtgctcga tcccaagcgg gtgaatgagc gttatgtcgc tgaggtggtg       360
     cgcgccggaa cgcgcgctcg cggtgtggtg tgccgcggcc aaggggagcc gggtgcgttt       420
     gtgttgcgcg gccgacgtct cgattgtccg gagggttggc ttgtgattaa cgacccccta       480
     ttgacgtcgt ctggagaaca acaaccagag ccgattaatt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page