(data stored in ACNUC29543 zone)

EMBL: CT978603.PE396

CT978603.PE396       Location/Qualifiers
FT   CDS_pept        complement(373996..376155)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0396"
FT                   /locus_tag="SynRCC307_0396"
FT                   /product="ATPase related to the helicase subunit of the
FT                   Holliday junction resolvase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27299"
FT                   /db_xref="GOA:A5GQZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ0"
FT                   /protein_id="CAK27299.1"
FT                   /translation="MWFMDLFGHHADQQLQQQAPLAERLRPRSLDEFIGQDAILGPGRL
FT                   LRRAIAADRLGSLILHGPPGTGKTTLARIIANTTRCHFSSLNAVLAGIKDLRAEVEQAQ
FT                   ERLGRHGLRTLLFIDEVHRFNTSQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRS
FT                   RLFRLQSLDQAALHQVLDRALSDRTHGYGERSIQLDAEARAHLVEVAGGDARSLLNALE
FT                   LAVETTDANASGAIQITLAVAEESIQQQAVLYDKQGDAHFDTISAFIKSIRGSDPDAAL
FT                   FWLARMVEAGEDPRFIFRRLLISAGEDIGLADPQGIVVVEACATAFDRIGLPEGLYPLV
FT                   QATLYLAGASKSNSALGFFDAVKQLRQEKAQQIPKHLRDANRDGSAFGDGVGYRYPHAY
FT                   ADHWVAQQYLPNALQGQVFYQPGSLGWEGERRQQLLTHRAAQLAAAVEWDSQQGEPLSS
FT                   GPDDPAVERWLQRQLALEEGRLVRLQQRFWHAIGLQRHHNVLVMGSRSLLWALPALSGT
FT                   PEGGVTLQLESSADIERIKAQLQVLDPLQQPALIEAPAHAVEGLGDERFELLIGRNLLQ
FT                   GANQRALKAWVKQLETLLYDNAEIHLMSSQPQAGPAELLNSDHPPLVEAEQGWLAKRQP
FT                   LEQLQQLLAAANWSVTKEQWTDQVSLQVDSGLITRWFSKQATYRQAMEGQLGVQAIKAL
FT                   KESYQKRIGTKLRQTISHQHLVARR"
     ttgtggttca tggacctgtt cggccaccac gccgatcaac agctgcagca acaagccccg        60
     ctcgcggagc gactgcggcc gcgcagcctt gatgagttca ttggccaaga cgccatcctg       120
     gggccaggcc gcctgctacg ccgtgcgatc gcagccgatc gactcggcag cttgatcctg       180
     catggcccgc cgggcacggg caaaaccacc ctggcgcgga tcatcgccaa caccacgcgc       240
     tgccacttca gcagcctcaa cgccgtgctg gcaggcatca aggacctgcg cgcggaagtg       300
     gagcaagcgc aggagcgcct cggccgccat ggcctgcgca ccctgctgtt catcgatgaa       360
     gtgcatcgct tcaacaccag tcagcaagac gccctactgc cctgggtgga aaacggaacc       420
     gtcaccttga tcggagccac caccgagaac cccttctttg aggtgaacaa ggccttggtg       480
     agccgctcgc gcctatttcg actgcaatcg ctcgatcaag ccgcgctgca ccaggtcctc       540
     gatcgtgccc tcagcgatcg gacccatggc tacggcgaac gctcgatcca actggatgct       600
     gaggccagag cccatctggt ggaggtggct ggtggtgatg cccgtagctt gctgaatgcg       660
     ctggaactcg ccgttgaaac gactgatgcc aatgcctcag gagcgattca gatcaccttg       720
     gcggtagctg aggagtcgat ccaacaacaa gccgttctct acgacaagca aggggatgcc       780
     catttcgaca ccatcagcgc cttcatcaaa tcgattcgcg gcagtgaccc cgatgccgcc       840
     ctgttttggc tggcacgcat ggtggaagcc ggggaagatc cgcgtttcat cttccggcgt       900
     ctgctgattt cagctgggga agatatcggc ctggctgatc cccaggggat cgttgtggtg       960
     gaggcctgcg ctacagcctt tgatcggatt ggcctgccgg aagggcttta tccgttggta      1020
     caagcgacgc tgtatctcgc cggtgccagc aagagcaaca gcgccctggg attttttgat      1080
     gcggtcaagc agctgcgcca agaaaaagcg cagcagattc ccaagcatct gcgcgatgcc      1140
     aaccgtgatg gctcagcctt cggcgatggc gtggggtatc gctacccgca cgcctatgcc      1200
     gaccactggg tggcgcagca atacctcccc aatgcattgc aggggcaggt gttttatcaa      1260
     cctgggagcc tgggctggga aggtgagcgc cgccagcaac tactcacgca tagggccgcc      1320
     cagctcgcgg cggccgtgga atgggatagc caacagggag agccactcag cagtggcccc      1380
     gatgaccctg cggtggaacg ctggcttcag cgccaactgg ctttagaaga aggacggctg      1440
     gtgaggctgc agcaacgctt ttggcatgcc attggactgc agcggcacca caacgtgctc      1500
     gtcatgggca gccgcagcct gctatgggcc ttacccgccc taagcggaac acccgaaggc      1560
     ggcgtcaccc tgcagcttga gagcagcgcc gacatcgagc gcatcaaggc ccagctgcaa      1620
     gtgctggacc cgttgcagca acctgccctc atcgaagcac cagcccatgc cgttgagggc      1680
     ttgggggatg agcgtttcga actgctgatt ggccgcaacc tgctgcaggg agccaatcag      1740
     cgggccctca aggcgtgggt gaagcaattg gagacgttgc tctacgacaa cgccgaaatc      1800
     catctgatga gcagccagcc gcaagcgggg cctgctgaat tgctgaattc agaccaccct      1860
     cccctggtcg aagccgagca gggctggctg gcgaaacgcc aaccgctcga acagctgcag      1920
     cagctgctag ccgctgcaaa ctggagcgtg acaaaggaac agtggactga tcaggtcagc      1980
     ctgcaggtgg attcaggcct gatcacgcgc tggttctcca agcaagccac ctaccggcaa      2040
     gccatggagg gacaacttgg cgttcaagcc atcaaggctc tcaaggagag ctatcaaaag      2100
     cgcattggca ccaagctgcg ccaaaccatc agccatcaac acctggttgc acggcgctaa      2160
//

If you have problems or comments...

PBIL Back to PBIL home page