(data stored in ACNUC29543 zone)

EMBL: CT978603.PE397

CT978603.PE397       Location/Qualifiers
FT   CDS_pept        376209..377411
FT                   /transl_table=11
FT                   /gene="SynRCC307_0397"
FT                   /locus_tag="SynRCC307_0397"
FT                   /product="Possible membrane-fusion protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27300"
FT                   /db_xref="GOA:A5GQZ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ1"
FT                   /protein_id="CAK27300.1"
FT                   /translation="MDGSVRLFRGLIVLALCPLAGCSWLGSQGPKPLQVSTAVLQPEQF
FT                   RELGDYVATLEAVNQVQLAALADGRVVELPVEEGQQVEQGEVLLRLSSEERQAELIQAQ
FT                   AELSRRRADVAAVQADLERDRRNFERYRYLAKEGAANALDLDSFKASFLASQAKLEANQ
FT                   DLVEAAEAGLGVARTRLDYKTVRAPISGQVSDLSVKLGDVVKERDPFTAIVRNDRLYTQ
FT                   ITIPVTMAERTKPGLPVWLLDPTNGIELAKGELKFVDPDVKVATQGLLAKAEFSNPGNR
FT                   LRSGMRVRTLVGFGSSRQLAVPFDAVIRSAGQSFVYVIGPASELNAKQRQHFKQLKDDT
FT                   PVALKRAVSLGPLQNSCYPVLSGLEPGEQLISSHLLSLRQGTAVKAKASSLEVPICRPL
FT                   R"
     gtggatggtt ctgtgcgcct cttccgcggg ttaattgtgt tggccttgtg ccctttggct        60
     ggctgcagct ggttgggcag tcagggtccg aagcccctgc aggtgtccac tgccgtgctc       120
     cagcctgagc agttcaggga gctcggtgat tacgtcgcca cgttggaggc ggtgaatcag       180
     gtgcagttgg cggctttggc cgatggccgt gtggtggagc tgcccgttga agaaggccaa       240
     caggtggagc aaggggaggt gctgctgcgg ctctctagcg aggagcgcca agctgaattg       300
     attcaggcgc aggccgaact ctcaaggcgc cgcgctgatg ttgccgctgt ccaagctgat       360
     cttgagcgcg acaggcgcaa ctttgagcgc tatcgctacc tggccaaaga gggcgcagcc       420
     aatgcgctcg acctcgactc gttcaaggcc agcttcctgg cgagccaagc caaactggaa       480
     gccaaccaag atttggtgga ggccgctgag gcgggtctgg gcgtcgctcg caccaggttg       540
     gactacaaga ccgtgcgggc cccgattagc ggccaagtca gtgacctcag cgtcaagctc       600
     ggcgatgtgg tcaaagagcg cgacccattt accgcgatcg tgcgcaatga ccgtctctac       660
     acccagatca ccatccctgt gacgatggcg gagcgcacca aacctggttt gccggtgtgg       720
     ctgctggatc ccaccaatgg cattgagttg gccaaagggg aactgaagtt tgtcgacccc       780
     gatgtgaagg tggccaccca ggggctgttg gctaaggcgg aattcagcaa ccctggcaat       840
     cgcttgcgca gcggcatgcg ggtgcgcacc ttggtgggct ttggcagcag tcggcagttg       900
     gcggtgccgt ttgatgcggt gatccgcagt gccggccaga gttttgtgta tgtgattggg       960
     ccggccagtg agctcaacgc caagcagcgc caacacttca agcagctcaa ggacgacaca      1020
     ccggttgcgc tcaagcgggc cgtcagcctt gggccattgc aaaacagttg ttatcccgtg      1080
     ctgtcaggcc ttgagcccgg tgagcagttg atcagtagcc atctgttgag tttgcgtcag      1140
     ggaacagccg tgaaggccaa ggcgtcttcg ctcgaggtgc ctatctgtcg cccattgcgt      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page