(data stored in ACNUC29543 zone)

EMBL: CT978603.PE40

CT978603.PE40        Location/Qualifiers
FT   CDS_pept        complement(39089..39469)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0040"
FT                   /locus_tag="SynRCC307_0040"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26943"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY4"
FT                   /protein_id="CAK26943.1"
FT                   /translation="MAAKRYQLMALALGLSCMGSLPAEANEAGDKGAEIYCFMRKTGNS
FT                   HNVSWKAAYERIKRQSTGLFKTSPKHAAVMVTESVVTKQDKYQDCGKYLGALFAGGETT
FT                   GKDFDAGLSNESSTTDDDRYSY"
     atggctgcca agcgctacca actcatggca ttggccctgg ggctgagctg catgggcagc        60
     ctgccggctg aagccaatga agccggagat aaaggagccg agatctattg cttcatgcgc       120
     aagacgggca attcccacaa cgtcagctgg aaagcggcct acgagcgcat caagcgtcag       180
     agcactggcc tgttcaagac ctcgccgaag cacgcagccg tgatggtcac agaaagcgtg       240
     gtgaccaagc aggacaagta ccaagactgc ggcaagtacc tgggggccct cttcgccggc       300
     ggcgaaacca caggcaaaga ctttgatgcc ggcctgagca acgagagcag caccacagac       360
     gacgaccgct acagctactg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page