(data stored in ACNUC29543 zone)

EMBL: CT978603.PE400

CT978603.PE400       Location/Qualifiers
FT   CDS_pept        381839..382120
FT                   /transl_table=11
FT                   /gene="SynRCC307_0400"
FT                   /locus_tag="SynRCC307_0400"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27303"
FT                   /db_xref="GOA:A5GQZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ4"
FT                   /protein_id="CAK27303.1"
FT                   /translation="MPLPHPTGYRPRQQSRVDRRRIVLAGMLFGFFAVLLMVLGHRAAR
FT                   APGSSLKTMSLDHVLVVMFGVGFCGSWGETMRQLSLVARSRQTRNSLE"
     atgccattgc cccatccaac tgggtatcgc ccgcggcagc agagccgggt tgatcgccgt        60
     cggatcgtgc ttgctgggat gttgttcggt ttctttgctg tgctgctgat ggtgttgggc       120
     catcgagcgg ctagagcgcc gggctcaagc ctcaagacga tgtctcttga tcacgtgctg       180
     gtggtgatgt ttggtgtggg gttttgtggc agttggggtg aaacgatgcg tcagctttct       240
     ctggttgctc gcagccggca gacgcggaat tcattggagt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page