(data stored in ACNUC29543 zone)

EMBL: CT978603.PE401

CT978603.PE401       Location/Qualifiers
FT   CDS_pept        complement(382109..382948)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0401"
FT                   /locus_tag="SynRCC307_0401"
FT                   /product="Possible ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27304"
FT                   /db_xref="GOA:A5GQZ5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ5"
FT                   /protein_id="CAK27304.1"
FT                   /translation="MAPRASRLLPSLSRRQLQRVVLEADTPGGRLYNLIIFGTILLSVV
FT                   GLLLEPQPLSFSRELQRGGAVVWIDGFCLLVFLIDYLLHVALSPQPWRYIRSFYGVIDL
FT                   IAVLFFMVPQISSGVVLWMFKFGRILRVFKLLRFVDEADRLLISLRASARRIAVFILFV
FT                   VILQVFLGYLMVLVESGHPNSQFQSVGQGVYWAVVTMTTVGYGDVVPQTVLGRLLAAAV
FT                   MLLGFGIIAIPTGIVSYEAIRQGQNDQRQCSHCGYRGHRHGAEFCDRCGTLLPTSLQ"
     atggcgcccc gcgcttctcg ccttctgccc tctttaagcc gaaggcaact gcagcgggtt        60
     gtgctggaag ccgacacccc aggcggcagg ctctacaacc tcatcatctt tggcacgatc       120
     ctgctcagcg tggtggggct gttgctcgag ccacaaccgc tgagcttcag ccgcgagctg       180
     caacgaggtg gagctgtcgt ttggatcgac ggcttctgcc tgctcgtttt tctgatcgat       240
     tacctgctgc atgtggccct gagcccgcag ccatggcgct acatccgcag cttttacggc       300
     gtcatcgatt tgatcgccgt gctgtttttc atggtgccgc agatcagcag cggcgtggtg       360
     ctgtggatgt tcaaatttgg ccgcatcctg cgggtattca agctgctgcg atttgttgat       420
     gaagccgatc gattgctgat cagcctgcgg gccagtgcac ggcgcatcgc cgtcttcatc       480
     ctgtttgtgg tgattctgca ggtattcctc ggctacttga tggttttggt ggaaagcggt       540
     caccccaaca gtcaatttca aagcgttggg caaggggtct actgggctgt ggtgacgatg       600
     accaccgtgg gctacggcga tgtggtgccg caaacagtgc tcggacggct cctagcagca       660
     gcggtgatgt tgctgggctt cgggatcatt gccatcccaa ccggcatcgt gagttatgag       720
     gccatccgcc agggacaaaa cgaccaacgc caatgcagcc actgcggcta ccgaggccac       780
     cgacacggtg ccgaattttg cgaccgctgc ggcacgctgc tgccaacctc actccaatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page