(data stored in ACNUC29543 zone)

EMBL: CT978603.PE407

CT978603.PE407       Location/Qualifiers
FT   CDS_pept        complement(387744..389420)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0407"
FT                   /locus_tag="SynRCC307_0407"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27310"
FT                   /db_xref="GOA:A5GR01"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR01"
FT                   /protein_id="CAK27310.1"
FT                   /translation="MSNPPIEFTPRPISPRQRLLLGAGLFTALALALQFWRIYTLTATF
FT                   DQGLFLQEIWSALGGRPFESTLASELSSPVLLDKTALPTLGYLHLGQHFTPLLLLWVPL
FT                   VALLGPWSLPIVQIGLISAGGLVLYELARCDLDERIACWIALSYFASGTVIGPSLENFH
FT                   DLCAVPVLVFSLLLGIRRSNRWLYGTAALLLPLVREDVGLLAFSLGLWMVLRQPRWRLA
FT                   GVGLCLYATAAVVLITNTVQPLFGTEVSDRLLSARFGHFLSDQGGKGSTLDLLQAMALQ
FT                   PQRVVQELLTPLGPTLQLLVALWLPLGFLPILGLDAWLLMAVPLFLALAAQGVTALSIN
FT                   LRFMLYLVPGVFAGSVIWWRSRQALFEQRWVRRLWQSCAVASLVFALIGNPHHSLSMLI
FT                   PDSLNPWVYVSPWQQLQRGHQSRALTRNIPKDASVSAETQLIPMLAERRVLLRYPFNYR
FT                   YTDEQGQAHDVEWIVLQPRFKATYAPAFRRQANTLEHGMNLTQHLLASGSYEIARCGPS
FT                   GILLKHRSTTATGDLSTKANLKQCLHQEFERAQQVLNQRQR"
     atgagcaacc cgcccattga attcacgccg cggcccatct cgccgcggca acgtttgctg        60
     cttggggcag gtctgttcac agcccttgcc ctggctctgc agttctggcg gatctacacg       120
     ctcacggcca cctttgatca ggggctgttt ttgcaggaga tctggagtgc cttaggcggc       180
     cggccctttg agagcacgct cgcttcagag ctgtcatcac cggtgctgct ggataaaaca       240
     gccctgccaa ccctgggcta tctgcacctc ggccaacact tcacaccgct gttgctgctg       300
     tgggtgccgc tggtggccct actgggtccc tggagcttgc ccatcgttca gatcggcctg       360
     atcagcgctg gcggcctggt gctctatgaa ctggcccgct gcgatctcga tgaacgcatc       420
     gcctgctgga tcgccctgag ctacttcgct agcggcacag tgattggtcc cagcttggag       480
     aacttccacg acctttgcgc cgtgccggtg ctggtgttca gcctgctgct ggggattcgg       540
     cgcagcaatc gctggctcta tggaacggcc gctctgttgc tgcccttggt gcgcgaagac       600
     gtgggcctgc tggccttcag cttgggcctt tggatggtgc tgcgccagcc ccgctggcgc       660
     ttggctggag tggggctttg cctgtatgcc accgcggcgg ttgttctgat caccaacacg       720
     gttcaacccc tttttggcac tgaggtctcc gatcggctgc tgagcgccag gttcggccat       780
     ttcttgagtg atcaaggtgg caagggctcc acccttgatc tgctgcaggc catggcccta       840
     cagccccaac gcgttgtgca agaactgctc acccctttgg ggccaacgct gcagctactc       900
     gttgcccttt ggttgccact ggggttcctg ccgatccttg gcctcgatgc ttggttgttg       960
     atggcggtgc ctttgttctt ggccctggca gctcaagggg taacggccct ctcgatcaat      1020
     ctgcgcttca tgctgtatct cgtgccaggg gtgttcgctg gatcagtgat ctggtggcgc      1080
     tcacgccagg ccctgtttga gcagcgttgg gtgcggcggc tctggcaaag ctgcgctgtg      1140
     gcatcgctgg tgtttgcctt aatcggcaac ccccaccaca gcctgtcgat gctgattccc      1200
     gacagcctca acccgtgggt ctacgtctcc ccgtggcaac aactgcagcg gggccaccaa      1260
     agccgggccc tgacccgcaa cattcccaaa gacgccagcg tctcagctga aacgcaattg      1320
     attcccatgc tggctgaacg gcgtgtgctg ctgcgctatc ccttcaacta ccgctacacc      1380
     gacgagcagg gtcaagccca tgacgtcgag tggatcgtgt tgcagccgcg ctttaaagcc      1440
     acctatgccc cagccttccg ccggcaagcc aacaccctgg agcacggcat gaatctgacc      1500
     cagcacttgc ttgcgagcgg cagctatgag attgcccgtt gcgggccaag cggcatcctg      1560
     ctcaagcacc gcagcacaac ggcaacgggt gacctgagca ccaaggccaa cctcaaacag      1620
     tgcctccatc aagaatttga acgcgcccag caggtgctga accagcggca gcgatga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page