(data stored in ACNUC29543 zone)
EMBL: CT978603.PE411
CT978603.PE411 Location/Qualifiers
FT CDS_pept complement(393450..393731)
FT /transl_table=11
FT /gene="SynRCC307_0411"
FT /locus_tag="SynRCC307_0411"
FT /product="Conserved hypothetical protein"
FT /db_xref="EnsemblGenomes-Gn:SynRCC307_0411"
FT /db_xref="EnsemblGenomes-Tr:CAK27314"
FT /db_xref="InterPro:IPR019595"
FT /db_xref="InterPro:IPR037119"
FT /db_xref="UniProtKB/TrEMBL:A5GR05"
FT /protein_id="CAK27314.1"
FT /translation="MAADPLTSAVSDRICAHMNDDHAEAVVAYARHYGGAENPSQARML
FT KVEPERMLLDVDGSELSIAFDHTLSDSEDAHRTLVAMLRAMPQPGNAD"
atggcagctg atcccctcac ctccgccgtt agcgatcgca tttgcgctca catgaacgac 60
gaccacgccg aggcggtggt ggcctacgcg cgccattacg gcggcgcgga gaacccaagc 120
caggcccgca tgctgaaggt ggaacccgag cggatgctgc tggatgtcga tggcagcgag 180
ctcagcatcg cctttgatca caccctcagc gacagcgaag acgcccaccg caccctggtg 240
gcgatgctgc gcgccatgcc ccaaccgggg aacgctgact aa 282
//
If you have problems or comments...
Back to PBIL home page