(data stored in ACNUC29543 zone)

EMBL: CT978603.PE411

CT978603.PE411       Location/Qualifiers
FT   CDS_pept        complement(393450..393731)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0411"
FT                   /locus_tag="SynRCC307_0411"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27314"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR05"
FT                   /protein_id="CAK27314.1"
FT                   /translation="MAADPLTSAVSDRICAHMNDDHAEAVVAYARHYGGAENPSQARML
FT                   KVEPERMLLDVDGSELSIAFDHTLSDSEDAHRTLVAMLRAMPQPGNAD"
     atggcagctg atcccctcac ctccgccgtt agcgatcgca tttgcgctca catgaacgac        60
     gaccacgccg aggcggtggt ggcctacgcg cgccattacg gcggcgcgga gaacccaagc       120
     caggcccgca tgctgaaggt ggaacccgag cggatgctgc tggatgtcga tggcagcgag       180
     ctcagcatcg cctttgatca caccctcagc gacagcgaag acgcccaccg caccctggtg       240
     gcgatgctgc gcgccatgcc ccaaccgggg aacgctgact aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page