(data stored in ACNUC29543 zone)

EMBL: CT978603.PE423

CT978603.PE423       Location/Qualifiers
FT   CDS_pept        402836..403930
FT                   /transl_table=11
FT                   /gene="SynRCC307_0423"
FT                   /locus_tag="SynRCC307_0423"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptak"
FT                   /note="DNA replication, recombination, and repair /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27326"
FT                   /db_xref="GOA:A5GR17"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR17"
FT                   /protein_id="CAK27326.1"
FT                   /translation="MIVGRRSWWWTWLQVPGVGISRIKQLEQAFGSLQAAWWAPAEQLL
FT                   ALPGVGPSLLAGRDQLQQRASALPLPVPPKVLLPSDLAMPPALMALPQPPAALFWCGRG
FT                   ALWPLLRRQQAIAVIGSRRASPYGCRWAQQLGVALAAAGWPVISGLAEGVDAQAHQGCL
FT                   EAGGTPIAVLGTSLERVYPRHHQRLQSQVGRRGLLISEQAPGAPGLRGAFAKRNRLLVA
FT                   MAQAVVLVECPQRSGALLAAQIAWSLQRPLWVVPADSDRASAAGSNGWLNQGATALLDP
FT                   TQLVEALGPGPLQPLALPQRPDPSPLLSALGSGASFEALQRRLHLSPGALAQQLLHHQQ
FT                   QGWIEALPGLCWRPRHTEIDLPVA"
     gtgattgttg ggcgcaggag ttggtggtgg acctggcttc aggtccctgg tgttgggatc        60
     agccggatca agcagctgga gcaggccttt ggcagcttgc aagcggcgtg gtgggcgcct       120
     gctgagcagc tgttggcgtt gccaggcgtg gggccatcgc tgctggcagg ccgtgatcag       180
     ctgcagcagc gggcttcagc gctgcccttg ccagtgccgc ccaaggtgtt gctgcccagc       240
     gatttagcca tgccaccggc actaatggcg ctgccgcagc cgcccgcagc gctgttttgg       300
     tgcggtcgcg gcgcgctatg gccgttgctg cgccgccagc aggccattgc cgtgattggt       360
     agccgccggg cttctcccta tggctgccgc tgggcgcagc agttgggcgt tgccctggct       420
     gctgcgggct ggccggtgat cagtgggctg gcggaaggcg ttgatgctca ggcccaccag       480
     ggctgtttag aggctggggg cacgcccatt gccgtactgg gcacctcgct ggagcgggtc       540
     tatccgcgcc atcaccagcg gcttcaaagc caggtgggta ggcggggttt gttgatctcc       600
     gagcaagcgc caggggctcc tggattgcgg ggcgcgtttg ccaaaaggaa tcgcttgttg       660
     gtggcgatgg cccaagccgt ggtgttggtg gagtgcccgc agcgcagtgg tgccctcttg       720
     gcggcccaga tcgcctggtc gctgcagcgg ccgctttggg tggtgcctgc tgatagtgat       780
     cgcgcatcgg ctgctggcag caatggctgg ctcaaccaag gggcgaccgc cctgctcgat       840
     cccactcaac ttgtggaggc cttgggccca ggtccgttgc agccgctggc gctgccgcag       900
     cggccagacc catcaccgct gctgagcgcc ttgggttcgg gagccagttt tgaggcgctg       960
     caacggcgat tgcacctctc cccaggagcc ttggcgcagc aactgctgca ccatcagcag      1020
     cagggctgga ttgaagctct gcctgggttg tgctggcgtc cgcgtcacac tgagattgat      1080
     ctgcctgtgg cctag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page