(data stored in ACNUC29543 zone)

EMBL: CT978603.PE432

CT978603.PE432       Location/Qualifiers
FT   CDS_pept        410293..410454
FT                   /transl_table=11
FT                   /gene="SynRCC307_0432"
FT                   /locus_tag="SynRCC307_0432"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27335"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR26"
FT                   /protein_id="CAK27335.1"
FT                   /translation="MLVRTTHGSISVVGGYGWVNVVPERPSRFESRRPLHWAGWVWDVI
FT                   SQRSLTPS"
     ttgttggttc gcacaactca cggcagcatc agtgtggttg gtggctatgg ctgggtgaat        60
     gtggttccgg aacgtcccag ccgctttgag tcacgccgtc cgttgcattg ggctggttgg       120
     gtttgggacg tgatctccca acgctccctg acaccatcct ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page