(data stored in ACNUC29543 zone)

EMBL: CT978603.PE433

CT978603.PE433       Location/Qualifiers
FT   CDS_pept        410513..410791
FT                   /transl_table=11
FT                   /gene="SynRCC307_0433"
FT                   /locus_tag="SynRCC307_0433"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27336"
FT                   /db_xref="GOA:A5GR27"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR27"
FT                   /protein_id="CAK27336.1"
FT                   /translation="MFASQYSPLEIVLLKPERIEEMEQAVQWLQRHSTVVVDMALLDDS
FT                   NAQRFIDFLSGAVWSLDGSIQRVSDEVIVAAPMAIRLTSGSEAETEI"
     atgtttgcta gccaatactc cccgctcgaa atcgttctcc tcaagcctga gcggattgag        60
     gagatggagc aggctgtgca atggctgcag cgccactcaa cggttgttgt cgacatggcc       120
     ttgctggatg acagcaacgc ccagcgtttt attgacttcc tctctggcgc tgtttggtcg       180
     ctggatggtt cgatccagcg ggtgagtgat gaggtgatcg tggcggcgcc catggcgatc       240
     cgtctcacct caggttcaga ggcagagacc gaaatctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page