(data stored in ACNUC29543 zone)

EMBL: CT978603.PE435

CT978603.PE435       Location/Qualifiers
FT   CDS_pept        complement(411070..411846)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0435"
FT                   /locus_tag="SynRCC307_0435"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27338"
FT                   /db_xref="InterPro:IPR024981"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR29"
FT                   /protein_id="CAK27338.1"
FT                   /translation="MGHNGSDFGLGLPVLKRSAMAKAAAALLACTAITPFTLPAAAQSS
FT                   RVARPLSEAAAQQAADQILEAVRQRDGALRYSQFSKALQTTSSPSMVQGTLDQLPQLES
FT                   WTIQSVRTGLSGNSSVEVLLQSENGSREATLVINPQGRLVAQLFNVSDKDSTKVARAFI
FT                   DAVSDGQFISARSLLALDLQKEISPQKLQNKWLRLQQTTGNFQAIEKVMEAEHGSNGSL
FT                   VLVTMRFNRTTDNIFVILNPAGQITGLDFPIDGAVR"
     ttgggccaca atggctccga ttttggattg ggcctgcctg tgttgaagcg ttctgcaatg        60
     gccaaagcag cggccgccct gctggcttgc accgccatca cacccttcac cctccccgca       120
     gctgcccaga gcagccgcgt ggcgcgcccc ctgagcgaag cagccgccca gcaagcagct       180
     gatcaaattc tcgaagcagt gcgtcaacgt gacggcgctc tgcgctactc ccaattcagc       240
     aaggctctgc aaaccaccag cagcccatca atggtgcaag gcaccctcga tcaattgcct       300
     cagctcgaga gctggaccat tcagtcggtg cgcactggcc tcagcggcaa cagctccgtt       360
     gaggtgttac ttcaaagcga aaatggcagc cgtgaagcca ccttggtaat caacccccaa       420
     ggtcgcctcg tcgcccagct gttcaacgtc tcagacaaag actccaccaa ggtggcgcgg       480
     gccttcatcg atgcggtgag cgatggccaa ttcatcagcg cccgcagcct cctagccctc       540
     gacctgcaaa aagagatcag ccctcaaaag ctgcagaaca agtggctgag gctgcagcag       600
     accaccggga atttccaggc gatcgagaag gtgatggaag ctgagcatgg gagcaacggc       660
     tccctggtgc tcgtcaccat gcgcttcaac cgcaccaccg acaacatctt tgtgatcctc       720
     aacccggctg ggcagatcac cggacttgat ttcccaatcg atggagccgt gcgttga          777
//

If you have problems or comments...

PBIL Back to PBIL home page