(data stored in ACNUC29543 zone)

EMBL: CT978603.PE440

CT978603.PE440       Location/Qualifiers
FT   CDS_pept        414765..415334
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="SynRCC307_0440"
FT                   /product="Chromate transport protein ChrA"
FT                   /note="Possible HGT"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27343"
FT                   /db_xref="GOA:A5GR34"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR34"
FT                   /protein_id="CAK27343.1"
FT                   /translation="MVDPSSAWDTWLQVVWTFLRLSLFSLGGGNTLLAEYHHLSVERFG
FT                   WITSSQFADIYALAEAAPGPSSMIVGLLGLGAGWDHGLGWGLLCGVSAEVAVLLPSTVV
FT                   MVAAALSWNRLKDAPIRTAFERGLGPITLGILFHVGLTVLRTADHSVVAYLVSAVVCAL
FT                   MLFTRISPLYFMAVAGVLGAIGVIPS"
     atggttgatc ccagcagcgc ttgggacacc tggcttcagg tggtgtggac cttcctgcgc        60
     ctgtcgctgt tttccctcgg cggcggcaac accttgctgg cggaatacca ccacctctcg       120
     gtagagcgct ttggctggat caccagctcc cagttcgctg acatctatgc cctcgctgaa       180
     gcagcgcctg ggcccagctc catgatcgtg gggctcttgg ggctgggggc tggctgggac       240
     cacggcctgg ggtggggcct gttgtgtggg gtgagcgctg aggtggcggt gttgctgccc       300
     tccaccgtgg tgatggtggc ggcggccttg agctggaacc ggctcaaaga tgcaccgatt       360
     cgcaccgcct ttgaacgggg cttggggcca atcacattgg gaatcctgtt ccatgtgggc       420
     ctcaccgtgc tgcgcacggc ggaccacagc gtggtggctt atttggtttc ggctgtggtc       480
     tgcgccttga tgttgttcac gcgcatctca ccgctgtatt tcatggcggt tgccggggtg       540
     ctgggcgcca ttggcgtcat ccccagctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page