(data stored in ACNUC29543 zone)

EMBL: CT978603.PE454

CT978603.PE454       Location/Qualifiers
FT   CDS_pept        complement(427053..427685)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0454"
FT                   /locus_tag="SynRCC307_0454"
FT                   /product="LysM-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27357"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR48"
FT                   /protein_id="CAK27357.1"
FT                   /translation="MVRPSNYSLVMRKSLLALLVVMAALPARAQEGVHVMQPKQTLYAV
FT                   SRMYGVPVKTLLQINNFANPNKIKVGTAIRLPAGTKAVNSPATTLATQSVPESTAPTTT
FT                   ETAVVTTVESEDDDTAVLAKKTPTTDWRYFGPLQVDWNNWRTMAGSLVAPTLNKQKQPL
FT                   YVAVNCGARKLNITGSGGTWKTWESPAEAFERDLVKAACADPKIGKG"
     atggtgcgcc catcgaatta ttcgctggtc atgcgtaaat ccctgcttgc cctgctggtg        60
     gtgatggcgg ctcttcctgc gcgggcgcag gaaggggtgc atgtgatgca gcccaagcag       120
     accctctatg cggtctcgcg catgtatggc gtgccagtga agacgctgct gcagatcaat       180
     aacttcgcta accccaacaa gatcaaggtc ggcaccgcca tccgccttcc ggccggcacc       240
     aaggccgtga actcaccagc cacgacgctg gccacccaat cggttcctga gagcaccgcc       300
     ccaacaacca ccgaaacggc agtcgtgacg actgttgaaa gcgaggacga cgacaccgca       360
     gtgctggcga aaaagacgcc aaccaccgac tggcgttatt tcggcccact gcaggtggat       420
     tggaacaact ggcgcaccat ggccggcagc ctggtggccc caaccctgaa taagcaaaaa       480
     cagcccctct atgtggccgt taactgcggc gcccgcaagc tcaacatcac cggctcaggc       540
     ggcacctgga aaacctggga atctccggct gaagcctttg agcgcgactt ggtgaaagcc       600
     gcctgcgccg atcccaaaat cggcaaaggc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page