(data stored in ACNUC29543 zone)

EMBL: CT978603.PE46

CT978603.PE46        Location/Qualifiers
FT   CDS_pept        complement(42331..42774)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0046"
FT                   /locus_tag="SynRCC307_0046"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26949"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ0"
FT                   /protein_id="CAK26949.1"
FT                   /translation="MRRPALLLGSALVALALAACQSKPTPQQSEQKAESAVCANLAAVG
FT                   KALEAVGELGPTSTVGDAEQARNNLAQAVAKLQDSEAALEKLRIQDLQKQVMAFNKEAK
FT                   KITANKSTTLEEAANELQGKLEPVLAARQAAVADVNCDAGGAS"
     atgcgtcgtc ctgccttgct gctgggatct gccctggtgg cccttgcact ggctgcctgc        60
     caaagcaaac caacgcctca gcaaagcgag caaaaggctg aatcagcggt gtgcgccaac       120
     ctggccgctg tcggcaaggc cctcgaagcc gttggcgagc tcggccccac ctccaccgtt       180
     ggtgatgccg aacaagcccg caacaacctg gcccaagccg tggccaagct ccaggactcc       240
     gaagccgccc tggaaaaact gcggattcag gacctgcaaa agcaagtgat ggccttcaac       300
     aaggaggcaa agaaaatcac cgccaacaag agcaccaccc tggaagaggc tgccaacgaa       360
     ctgcaaggca agctggaacc agtgctggcc gcacgccagg ctgccgtggc tgatgtgaac       420
     tgcgatgcag gtggcgccag ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page