(data stored in ACNUC29543 zone)

EMBL: CT978603.PE465

CT978603.PE465       Location/Qualifiers
FT   CDS_pept        complement(435115..435495)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0465"
FT                   /locus_tag="SynRCC307_0465"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27368"
FT                   /db_xref="GOA:A5GR59"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR59"
FT                   /protein_id="CAK27368.1"
FT                   /translation="MIDLIITSIVVDLSDQKLYAYNGPQLVRTIPVSSGKASTPTPTFS
FT                   SKVQSKHRSVTMRGRGYVAPGVPWAMCVPGGMICMHGAPWQEAAGQPYGVPRSHGCVRM
FT                   PTVQAKWLFHRTKTGTPITIQT"
     atgatcgatc tcatcatcac cagcatcgtg gtcgaccttt ccgaccagaa gctgtacgcc        60
     tacaacggtc cgcagctggt gcgcaccatt ccggtgagct ctggcaaggc atcgactccg       120
     acccccacct tcagcagcaa ggtgcagtcc aagcatcgct ccgtgaccat gcgcggacgc       180
     ggctatgtgg cccctggtgt gccctgggcc atgtgcgttc ccggcggcat gatctgcatg       240
     catggcgccc cttggcagga agccgcaggt cagccctatg gcgttccccg cagccacggt       300
     tgcgtgcgca tgccaacggt tcaggctaag tggctgttcc accgcaccaa aaccggcacc       360
     cccatcacga ttcagacctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page