(data stored in ACNUC29543 zone)

EMBL: CT978603.PE468

CT978603.PE468       Location/Qualifiers
FT   CDS_pept        437967..438233
FT                   /transl_table=11
FT                   /gene="SynRCC307_0468"
FT                   /locus_tag="SynRCC307_0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27371"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR62"
FT                   /protein_id="CAK27371.1"
FT                   /translation="MSVERYLNHPTFGMLYRVCPVATGEEIYATLYAQRMFFRVTSQPQ
FT                   GTSFEAMPFSDARHHAEQNLLRLRRNQSPELPLWKKLFDQTFI"
     atgagcgtcg agcgttatct caatcacccc accttcggga tgctctaccg cgtctgcccg        60
     gtggcaactg gtgaggagat ctacgccacg ctctatgccc agcggatgtt ctttcgcgtc       120
     acatcccagc cccagggaac cagctttgaa gcgatgccgt tttccgatgc gcgtcatcac       180
     gctgagcaaa acctgctgcg cttgaggcgc aatcagtcgc cggagttgcc gctctggaaa       240
     aagctgtttg atcagacttt catttga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page