(data stored in ACNUC29543 zone)

EMBL: CT978603.PE47

CT978603.PE47        Location/Qualifiers
FT   CDS_pept        complement(42834..44024)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0047"
FT                   /locus_tag="SynRCC307_0047"
FT                   /product="DHSS soluble hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26950"
FT                   /db_xref="GOA:A5GPZ1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ1"
FT                   /protein_id="CAK26950.1"
FT                   /translation="MIHQPDSGPPPSGMKDKLQLMIPGPTPVPERVLLAMARHPIGHRS
FT                   GEFQQIVARTTEQLQWLHQTKGDVLVLAGSGTAAMEAGIINVLSRGDKVICGDNGKFGE
FT                   RWVKVAKAYGLEVEVIKAEWGQPLDPEAFRNALEADTAKAIKAVILTHSETSTGVINDL
FT                   ETINRHVKAHGEALIVVDAVTSLGACSVPVDAWGLDVVCSGSQKGYMIPPGLGFVAMGE
FT                   RAWAAQKQSDLPKFYLDLERYRKAAAGNSNPFTPPVNLYFALEAALDLMQDEGLEAIFA
FT                   RHDRHRRASQAAMRALGLPLFAADGYGSPAITAVAPAGLDAEALRKAVKGRYDILLAGG
FT                   QDHLKGKVFRIGHLGFVCDRDVLTAVAAIEGALADLGVASAQPGAGVAAAAAVLQG"
     atgatccacc agccggattc cggcccccca cccagcggca tgaaggacaa gcttcaactg        60
     atgatccctg gccccactcc ggtgccggaa cgggtgctcc tggcgatggc acgccatccc       120
     atcggccacc gcagcgggga gttccaacaa atcgtggccc gcaccaccga gcagctgcaa       180
     tggctgcacc aaaccaaggg cgatgtgctg gtgctcgctg gcagcggcac ggcggccatg       240
     gaagccggaa tcatcaacgt gctcagccgc ggcgacaagg tgatctgtgg cgacaacggc       300
     aaattcggcg agcgctgggt gaaggtggcc aaggcctatg gccttgaagt ggaagtcatc       360
     aaggcggaat ggggccagcc cttggatccc gaagccttcc gcaacgcttt ggaagccgac       420
     accgccaaag cgattaaggc ggtgatcctc acccactcgg aaacctccac cggcgtcatc       480
     aacgacctcg agaccatcaa ccgccacgtc aaagcccatg gggaggcctt gatcgtggtg       540
     gatgcggtca ccagcctcgg cgcctgctcg gtgccagtgg atgcctgggg gctggatgtg       600
     gtctgctcgg gctcacaaaa gggctacatg attccgccag gccttggctt tgtggccatg       660
     ggcgagcggg cctgggccgc tcaaaagcaa tccgatttgc cgaagtttta tctggatctc       720
     gagcgctacc gcaaagcagc ggcgggcaat agcaacccct tcaccccccc ggtcaacctc       780
     tacttcgctc tggaggctgc cctggatctg atgcaagacg aggggctaga ggcgattttt       840
     gcccgccacg accggcaccg ccgcgccagt caagctgcca tgcgcgccct tggcttgccc       900
     ctgttcgccg ccgatggcta cggaagccct gccatcaccg ccgtggcacc agctggcctg       960
     gatgctgagg ccctgcgcaa agccgtcaaa ggccgctacg acatcctgct ggcgggcggc      1020
     caagatcacc tcaaagggaa ggtgttccgc atcggccacc tgggctttgt gtgcgatcgc      1080
     gacgtactca ccgccgttgc cgccatcgaa ggtgccctgg cggatctcgg cgtggcttca      1140
     gcccaaccgg gggctggtgt tgctgccgcc gctgcggtgc ttcagggcta a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page