(data stored in ACNUC29543 zone)

EMBL: CT978603.PE472

CT978603.PE472       Location/Qualifiers
FT   CDS_pept        complement(440319..440921)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0472"
FT                   /locus_tag="SynRCC307_0472"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27375"
FT                   /db_xref="GOA:A5GR66"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR66"
FT                   /protein_id="CAK27375.1"
FT                   /translation="MNPLAILVVPLGYLLGSFPSGYLAGRWCAGVDIRQLGSGSTGATN
FT                   VLRQVGKGPALVVFLVDVFKGSAAVILARALLGAGAYGWLVAAGLAALAGHIWPIWLGG
FT                   KGGKAVATGFGMLLGLVPAVGMACLGVFLTSLALSRIVSISSVLAAAALPLLMAGAGAP
FT                   GAYLGLGVVAAVMVIWRHRSNLSRLLKGEEPRLGQKD"
     ttgaacccat tggcaatttt ggtggtgccg ttgggctacc tgctcggcag tttccccagc        60
     ggctatctcg ccggacgatg gtgcgctggc gtcgacatcc gccaactggg atcaggatcc       120
     accggcgcca ccaatgtgct caggcaggtg ggcaaagggc ctgccctggt ggtgtttctc       180
     gtggatgtgt ttaaaggcag cgccgcggtg atcctggcca gagccctgct aggggccggt       240
     gcctacggct ggttggtcgc cgccgggctg gcggcactgg cgggccacat ctggccgatc       300
     tggctgggcg gcaaaggtgg caaggccgtc gccacgggct ttggcatgct gctgggcctg       360
     gtgcctgccg ttggcatggc ctgcctaggc gtcttcctca ccagcctggc gctgagccgc       420
     atcgtgtcga tcagcagcgt gctggcagcg gccgccttgc cactcttgat ggctggtgct       480
     ggagcaccag gggcctacct cggcttgggt gttgtggccg cggtgatggt gatttggcgg       540
     caccgcagca acctgagcag gctcctcaaa ggcgaagagc cgcggctggg gcaaaaggac       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page