(data stored in ACNUC29543 zone)

EMBL: CT978603.PE475

CT978603.PE475       Location/Qualifiers
FT   CDS_pept        441915..442175
FT                   /transl_table=11
FT                   /gene="SynRCC307_0475"
FT                   /locus_tag="SynRCC307_0475"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27378"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR69"
FT                   /protein_id="CAK27378.1"
FT                   /translation="MTYFRRRELMPQGISPSMQRLVRRKLSRVLGGQAQVISLKEIKRK
FT                   GEWQGYCEVEGRLAQFRFIRGGRQLVVQPLLNVFRWDRSAS"
     atgacctatt tccgtcgccg tgagctcatg cctcagggga tctccccctc gatgcagcgc        60
     ctagttaggc gcaagctcag tcgtgtgctt ggcggtcagg cccaggtgat cagcctcaag       120
     gagatcaaac gcaaaggcga gtggcagggc tattgcgagg tggaagggcg tttggcccag       180
     ttccgcttca ttcgtggggg gcgtcagctg gtggtgcagc ctcttttaaa cgtgttccgc       240
     tgggaccgat ccgcgtcgtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page