(data stored in ACNUC29543 zone)

EMBL: CT978603.PE487

CT978603.PE487       Location/Qualifiers
FT   CDS_pept        complement(450714..451874)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0487"
FT                   /locus_tag="SynRCC307_0487"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27390"
FT                   /db_xref="GOA:A5GR81"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR81"
FT                   /protein_id="CAK27390.1"
FT                   /translation="MNGSNNDNNKEDNSALVPLAHQEVRYRAAPTWTRALQWAIVGCIG
FT                   FGFLYAVVARIDEVVIARGELKGMGAERPIKAPVSGVVSGIPVTEGELVTPGQVLIQFD
FT                   PEVNTERLRSLGRQKELESRRLKEEIQAFEAREDSLQAKLNSLQMTLKVEASIVDRMAG
FT                   LVSQGAIAEVQYLQQKNRLQELQSEIAQTEATLREVQAESIKSKQQIQRELADLERQLV
FT                   ETNKSQEYESLRAPVKGYVFDLIVASPGYAASSGETLLKIVPEGMLEASVFVTNADVGF
FT                   LRPKMPAQVRVDAYPFTQYGDIPGELKRVGKQSLEPDQQNPEPRFPAQVVLKRQYLEKR
FT                   GKLFPVSAGQSVSVNFIVRDKPVISLLTDSVEKAFDALRGIKTDQP"
     atgaacggct ccaacaacga caacaacaaa gaggacaaca gtgcattggt gcccttagcg        60
     caccaagaag tccgctaccg cgctgcaccc acatggacca gggccctgca gtgggccatc       120
     gtcggctgca tcggctttgg gtttctttac gcggtcgttg cccgcattga tgaggtagtc       180
     attgcccgcg gtgaactcaa aggcatggga gccgagcggc ccatcaaagc tcctgtctct       240
     ggggtcgtca gtggcatccc agtcaccgag ggggagctcg tcaccccggg ccaggtgttg       300
     atccagttcg accctgaggt gaacaccgag cggctgcgct ccctagggcg tcaaaaagag       360
     ctggagagca ggcgcctcaa ggaagaaatt caggcctttg aagcgcggga agacagcctg       420
     caggccaagc tcaacagctt gcaaatgacc ttgaaggtcg aagcctccat tgtcgatcgc       480
     atggctgggc tggtgagcca aggtgcgatt gccgaggtgc agtatctgca gcaaaaaaat       540
     cgactccaag agctgcaatc agaaattgcg caaaccgaag ccaccctgcg tgaggtgcag       600
     gccgagtcga tcaaaagcaa acagcagatc caacgcgaac tggctgatct cgagcgtcag       660
     ttggtggaaa ccaacaaatc ccaggagtac gaatccctgc gtgctccggt caagggctat       720
     gtgtttgatc tgatcgttgc cagtccgggc tatgccgcca gtagcggcga aaccctgctc       780
     aagatcgttc ctgagggaat gctggaagcc agtgtgtttg tcaccaatgc cgatgtgggg       840
     ttcttgaggc ccaagatgcc ggcccaagtc cgcgtcgatg cctatccctt cacccaatac       900
     ggcgatattc ctggggaact caaacgcgtc ggcaaacaat cgctcgagcc cgatcaacaa       960
     aaccccgaac cccgtttccc cgcccaagtg gtgctgaagc gtcaatacct cgaaaaacgc      1020
     ggcaaactct tccccgtgtc cgccggtcaa agcgtgtcgg tgaacttcat cgtgcgcgac      1080
     aagcccgtga tcagcctgct caccgattcg gtcgagaaag cctttgatgc cctgcgcggg      1140
     atcaaaaccg atcaaccctg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page