(data stored in ACNUC29543 zone)

EMBL: CT978603.PE491

CT978603.PE491       Location/Qualifiers
FT   CDS_pept        complement(455750..455992)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0491"
FT                   /locus_tag="SynRCC307_0491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27394"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR85"
FT                   /protein_id="CAK27394.1"
FT                   /translation="MLSPSTIATDRATWVIRAKREAVRRHGDRWGLAHDRTTIKLLFRW
FT                   DILSREERDLALRELREELHSKCQANPGMGKFRFY"
     ttgttgtcac caagcaccat tgcaacggat cgcgccactt gggtgatacg cgccaaacgg        60
     gaagccgtgc gtcgccatgg cgatcgctgg gggctggccc atgaccgcac cacgatcaaa       120
     cttctcttcc gctgggacat cctcagccgc gaagagcgcg atttagccct gcgtgagctc       180
     agagaagaac tgcacagcaa atgccaagcc aatccaggca tgggcaaatt tcgcttctac       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page