(data stored in ACNUC29543 zone)

EMBL: CT978603.PE492

CT978603.PE492       Location/Qualifiers
FT   CDS_pept        455983..456168
FT                   /transl_table=11
FT                   /gene="SynRCC307_0492"
FT                   /locus_tag="SynRCC307_0492"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27395"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR86"
FT                   /protein_id="CAK27395.1"
FT                   /translation="MTTRAHADHSISTYGGCGVMAWMPYTISTVEKKIKPTHITCTIKL
FT                   VFLLKRLSLTPSPAVR"
     gtgacaacaa gggcgcacgc cgatcactcg atctcaacgt atggaggctg tggggtgatg        60
     gcctggatgc cctacacaat ttcaactgtt gaaaagaaaa ttaagccaac gcacatcacc       120
     tgcaccatca agttggtgtt tttgctgaaa cggttgtcct taacaccttc acccgccgtg       180
     cgctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page