(data stored in ACNUC29543 zone)

EMBL: CT978603.PE493

CT978603.PE493       Location/Qualifiers
FT   CDS_pept        complement(456261..456524)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0493"
FT                   /locus_tag="SynRCC307_0493"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27396"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR87"
FT                   /protein_id="CAK27396.1"
FT                   /translation="MSVAVATTQTLLSTKISTEATEFMQPSIALSLNQHLELEQSRRHL
FT                   DGIDDLQRLKDMAKEFLLNWQLERAESKRIIQEELSPQSLSL"
     atgtctgtcg cagttgcaac aactcaaacg cttttgtcaa caaaaattag tacagaagcc        60
     actgaattca tgcagccgag cattgcactc tctctgaatc agcatcttga gcttgagcag       120
     agccgccgac accttgacgg cattgatgac ctgcaacgct taaaagatat ggccaaagag       180
     ttcttgctga actggcagct tgagcgcgct gaaagcaagc gcatcattca agaagagctg       240
     agcccccaga gcctctcact ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page