(data stored in ACNUC29543 zone)

EMBL: CT978603.PE494

CT978603.PE494       Location/Qualifiers
FT   CDS_pept        complement(456565..456843)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0494"
FT                   /locus_tag="SynRCC307_0494"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27397"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR88"
FT                   /protein_id="CAK27397.1"
FT                   /translation="MMSESAELLDHLLEAVGAVACSAQSPTHRAAAHKAMGEALQILQS
FT                   APIAALNGIQPQHSAQPSELEGGWHIGVVERSPKQAMAGTHTKQAQP"
     atgatgtcag agagtgccga attactcgac catttattag aagcagttgg cgcggttgct        60
     tgctcagcgc aatccccgac ccatcgcgcc gcagcccaca aagccatggg cgaagccctg       120
     cagatcttgc aatcggcccc gattgctgcg ctcaatggca ttcaacctca acactcagct       180
     cagccctctg aactcgaggg gggctggcac atcggcgttg tcgagagatc tcccaagcaa       240
     gccatggcag gaacccacac aaagcaggcg cagccttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page