(data stored in ACNUC29543 zone)

EMBL: CT978603.PE497

CT978603.PE497       Location/Qualifiers
FT   CDS_pept        458219..458671
FT                   /transl_table=11
FT                   /gene="SynRCC307_0497"
FT                   /locus_tag="SynRCC307_0497"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27400"
FT                   /db_xref="GOA:A5GR91"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR91"
FT                   /protein_id="CAK27400.1"
FT                   /translation="MSCAVNHPSVDLSMAIQISMAPAFLLVAISNLINGITATRQRIID
FT                   RYRELSAENRDVLIPPDDVEYEKSVLRHRVSLSTRAITLLTSAIMLIALVIFIIFISLV
FT                   SPAIDLTLTLAPLFAFAMLSVIVASVFFLRQLRVSSQQLRRIGLSA"
     ttgtcgtgtg cggtgaatca tccctcggtc gatctgagca tggcgattca gatctcaatg        60
     gccccggcat ttctgctggt ggcgattagc aacttgatca atggcatcac cgcaacgcgc       120
     caacgcatca ttgatcgcta tcgggagctc tcagcagaga accgggatgt gctcatccct       180
     cctgatgatg tcgagtatga aaaaagtgtg cttcgccatc gggtttcgct ctcgactcga       240
     gccatcacct tgctgaccag cgccatcatg ttgatcgcgt tggtgatctt catcatcttc       300
     atcagcttgg tgagtccagc gattgatctc accttgacct tggccccctt gtttgcattc       360
     gccatgttga gcgtgatcgt ggccagtgtg tttttcctca ggcagctgcg tgtgtcatca       420
     cagcagctgc gccgcatcgg tctttcggct tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page