(data stored in ACNUC29543 zone)

EMBL: CT978603.PE498

CT978603.PE498       Location/Qualifiers
FT   CDS_pept        complement(458668..458970)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0498"
FT                   /locus_tag="SynRCC307_0498"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27401"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR92"
FT                   /protein_id="CAK27401.1"
FT                   /translation="MRKRFFAGVTEKSRFDFPLRGFSRNPDLPLQLLTSDWGNDEGMTE
FT                   ITYQKLLAAWRFEVVRTQGGVLFIGPNHFFSLPHEPRTKAERKIAIAHIRSLCKL"
     ttgcgcaaaa gattttttgc tggcgtaaca gaaaagtcca gattcgactt tcccctcagg        60
     ggcttttcac gcaaccctga tctgccgctt cagctgctga ccagcgattg gggcaacgat       120
     gaagggatga cagagatcac ttaccagaag ctgttggcag cgtggcgctt tgaagtggtg       180
     cgcacgcaag gcggggtctt gttcatcggg cccaatcact ttttcagctt gccccatgaa       240
     ccacgcacca aggctgagcg caaaattgcg atcgcccaca tccggtctct ttgcaagctc       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page