(data stored in ACNUC29543 zone)

EMBL: CT978603.PE499

CT978603.PE499       Location/Qualifiers
FT   CDS_pept        complement(459162..459359)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0499"
FT                   /locus_tag="SynRCC307_0499"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27402"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR93"
FT                   /protein_id="CAK27402.1"
FT                   /translation="MRMGWMQNLWRRDLYARMARLYRLGQPDTKRIARLRAFGMSQRQI
FT                   ANNLGLKPELVNKSVGRYYS"
     atgcgcatgg gctggatgca aaacctgtgg cgccgcgacc tctacgcccg catggcccgt        60
     ctgtaccggt tggggcagcc cgacaccaag cgcattgcaa ggctgcgggc tttcggcatg       120
     tcgcaacgcc agatcgccaa caacttgggc cttaagcctg agctggtgaa caaaagcgtc       180
     ggccgctact actcctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page