(data stored in ACNUC29543 zone)

EMBL: CT978603.PE505

CT978603.PE505       Location/Qualifiers
FT   CDS_pept        complement(461083..461355)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0505"
FT                   /locus_tag="SynRCC307_0505"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27408"
FT                   /db_xref="InterPro:IPR023810"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR99"
FT                   /protein_id="CAK27408.1"
FT                   /translation="MPEKQQARLMGSSATGMATDKELIKEAGQELWNTVKKLRPGLPKE
FT                   ARSQLVLKALLTIGDLPDQLQASMVLGQIADQEPDEAPEKEGAKS"
     gtgcctgaga agcaacaagc taggttgatg ggctctagtg caacaggaat ggccacagac        60
     aaagagctga tcaaagaggc gggccaagag ctctggaaca ccgtcaagaa gctgcgtcct       120
     ggcctgccga aagaagcccg ctcccagctg gtgctcaaag ctctgctgac cattggcgat       180
     ctccccgatc aactgcaagc ttcgatggtg cttggacaaa ttgctgatca ggagcccgat       240
     gaggcgcctg agaaagaagg cgccaaaagc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page