(data stored in ACNUC29543 zone)

EMBL: CT978603.PE506

CT978603.PE506       Location/Qualifiers
FT   CDS_pept        461419..461595
FT                   /transl_table=11
FT                   /gene="SynRCC307_0506"
FT                   /locus_tag="SynRCC307_0506"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27409"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA0"
FT                   /protein_id="CAK27409.1"
FT                   /translation="MKPCSWLAIAVMLSLWASGVVAQQAEEPDQPADRAEDCRIGVDEM
FT                   EHFRRTRRLTKSC"
     atgaagccct gctcttggtt ggcgattgca gtgatgctct ctctctgggc ctctggtgtt        60
     gtggctcaac aagctgagga gcccgatcag cccgctgatc gggcagagga ttgccgcatt       120
     ggcgttgatg aaatggagca ctttcggcgc actcgccggt taaccaaaag ctgctga          177
//

If you have problems or comments...

PBIL Back to PBIL home page