(data stored in ACNUC29543 zone)

EMBL: CT978603.PE508

CT978603.PE508       Location/Qualifiers
FT   CDS_pept        461880..462380
FT                   /transl_table=11
FT                   /gene="SynRCC307_0508"
FT                   /locus_tag="SynRCC307_0508"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27411"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA2"
FT                   /protein_id="CAK27411.1"
FT                   /translation="MHPMLSGSMFKLVSVAAPGLVAIVLGLGGCASFDQNKPAAQSDAA
FT                   SATKELQIKPILQTTTGLSGKTFTYPEGEAELRLLRVEFPVGGSVPLHTHPAPLIAYVS
FT                   QGQIRHTRGDQVNTFGPGQAFVESDQGGPHTVENIGEEPAVVFVAVASKQGLPTTNFMT
FT                   SAP"
     atgcatccaa tgctcagcgg cagcatgttc aagctggttt cggtggcagc gcctggcctg        60
     gtagccattg tcttggggct cggcggctgt gcgtcgtttg atcagaacaa accagcggcc       120
     cagagcgacg ccgcatcagc aaccaaggag ttgcaaatca agccaatcct gcaaaccacc       180
     actgggttga gcggcaaaac attcacctat ccagaaggag aggcggaatt gcgccttttg       240
     cgtgtggaat tccctgttgg cggaagtgtt cccctgcaca cccatcctgc gccgttgatc       300
     gcctacgtct cacaaggtca gatccgccat acaaggggtg atcaggtcaa cacgtttgga       360
     cctggccagg catttgtgga aagcgatcag ggtggccccc acaccgttga aaacattggt       420
     gaggagccag ctgtggtgtt tgtggcggtg gcctcaaaac aaggcctgcc caccaccaac       480
     ttcatgactt cagcgccatg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page